PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 472123
Common NameARALYDRAFT_472123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 288aa    MW: 31406.1 Da    PI: 6.7999
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
472123genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.27.8e-13103147347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+++++ + ++ G+g+Wk I+r + k Rt+ q+ s+ qky
           472123 103 PWTENEHKRFLIGLQKVGKGDWKGISRNFVKSRTPTQVASHAQKY 147
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.05496152IPR017930Myb domain
SuperFamilySSF466891.05E-1697152IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1799150IPR006447Myb domain, plants
SMARTSM007171.1E-6100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-10102147IPR009057Homeodomain-like
CDDcd001671.90E-6103148No hitNo description
PfamPF002492.4E-9103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAAVSSSSET GDCGAIGKRD EIMLFGVRVV VDPMRKCVSL NNLSDYEKSS PEDEIPKIVV  60
AGAGDGEDKN EADATVIVAD GYASANDAVQ ISSSSGRRKR GVPWTENEHK RFLIGLQKVG  120
KGDWKGISRN FVKSRTPTQV ASHAQKYFLR RTNLNRRRRR SSLFDITTET VTEMHMEQDP  180
TQENSPPPET NTSSGHQVMQ VFPEVAVPTK TENAPQTFHL NDPYLVPVTF QAKSAFNLNT  240
DAAPLSLNLS LASSFNLNEQ PNSIHSAFAM MPSFSNGDSN SSIIRVA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3168150.0AK316815.1 Arabidopsis thaliana AT1G19000 mRNA, complete cds, clone: RAFL08-11-F04.
GenBankAY0458810.0AY045881.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At1g19000) mRNA, complete cds.
GenBankAY0794150.0AY079415.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At1g19000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893027.10.0myb family transcription factor
SwissprotQ2V9B01e-55MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLD7KH900.0D7KH90_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.1__2077__AT1G19000.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.21e-171MYB_related family protein